US 11,707,504B1
الصحة - Health
2023
مكتب البراءات الأمريكي - US Patent Office
Mahmoud Kandeel Elsayed, Al-Ahsa (SA); Abdullah I. Al-Mubarak, Al-Ahsa (SA)
Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #1 (SEQ ID NO:1: SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL), peptide #4 (SEQ ID NO:2: SLTQINWTLLDLTYEMESLQQVVKALNESYIDLKEL), and peptide #11 (SEQ ID NO:11: SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDLKEL). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.