عـرض براءة الإختـراع

Fusion peptide inhibitors of human coronavirus 229E

• رقــم البراءة

  US 11,939,354 B1

• المجـال العلمى

  الصحة - Health

• سنة الإصدار

  2024

• مكتـب التسجيـل

  مكتب البراءات الأمريكي - US Patent Office

• أسماء المخترعين

  Kandeel; Mahmoud (Al-Ahsa, SA)

• نبذة عن البـراءة

  Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.