US 11,866,461B1
الصحة - Health
2024
مكتب البراءات الأمريكي - US Patent Office
Mahmoud Kandeel, Al-Ahsa(SA)
Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.